NINJ1_MOUSE   O70131


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O70131

Recommended name:Ninjurin-1

EC number:

Alternative names:(Nerve injury-induced protein 1)

Cleaved into:

GeneID:18081

Gene names  (primary ):Ninj1

Gene names  (synonym ):

Gene names  (ORF ):

Length:152

Mass:16555

Sequence:MESGTEEYELNGDLRPGSPGSPDALPPRWGLRNRPINVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNDFAFFVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPVMDVAPRQ

Tissue specificity:

Induction:By nerve injury.

Developmental stage:

Protein families:Ninjurin family


   💬 WhatsApp