PA1B3_MOUSE Q61205
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61205
Recommended name：Platelet-activating factor acetylhydrolase IB subunit alpha1
EC number：EC 3.1.1.47
Alternative names：(PAF acetylhydrolase 29 kDa subunit) (PAF-AH 29 kDa subunit) (PAF-AH subunit gamma) (PAFAH subunit gamma)
Cleaved into：
GeneID：18476
Gene names (primary )：Pafah1b3
Gene names (synonym )：Pafahg
Gene names (ORF )：
Length：232
Mass：25853
Sequence：MSGEGENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHSHTAEQVTGGIKAIVQLVNKLQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGYPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGIPLPETAS
Tissue specificity：
Induction：
Developmental stage：Expressed already by the time of neurulation. By 10.5 dpc, expression is abundant in the developing central and peripheral nervous systems. Major sites include the neuroepithelium of the fore-, mid-, and hindbrain, the spinal cord, the dorsal root, and cranial ganglia. In adult brain, expression is greatly diminished.
Protein families：'GDSL' lipolytic enzyme family, Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily