S10A9_RAT P50116
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P50116
Recommended name：Protein S100-A9
EC number：
Alternative names：
Cleaved into：
GeneID：94195
Gene names (primary )：S100a9
Gene names (synonym )：Mrp14
Gene names (ORF )：
Length：113
Mass：13,145
Sequence：MAAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQDNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK
Tissue specificity：Highly expressed at sites of inflammation. 2 s
Induction：
Developmental stage：
Protein families：