I11RA_MOUSE Q64385
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64385
Recommended name：Interleukin-11 receptor subunit alpha-1
EC number：
Alternative names：(IL-11 receptor subunit alpha-1) (IL-11R subunit alpha-1) (IL-11R-alpha-1) (IL-11RA1) (Enhancer trap locus homolog 2) (Etl-2) (Novel cytokine receptor 1) (NR-1) (NR1)
Cleaved into：Soluble interleukin-11 receptor subunit alpha (sIL-11R) (sIL-11RA) (sIL11RA)
GeneID：16157
Gene names (primary )：Il11ra1
Gene names (synonym )：Etl2 Il11ra
Gene names (ORF )：
Length：432
Mass：46655
Sequence：MSSSCSGLTRVLVAVATALVSSSSPCPQAWGPPGVQYGQPGRPVMLCCPGVSAGTPVSWFRDGDSRLLQGPDSGLGHRLVLAQVDSPDEGTYVCQTLDGVSGGMVTLKLGFPPARPEVSCQAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRCVVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQSILRPDPPQGLRVESVPGYPRRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEEVITDAVAGLPHAVRVSARDFLDAGTWSAWSPEAWGTPSTGPLQDEIPDWSQGHGQQLEAVVAQEDSPAPARPSLQPDPRPLDHRDPLEQVAVLASLGIFSCLGLAVGALALGLWLRLRRSGKDGPQKPGLLAPMIPVEKLPGIPNLQRTPENFS
Tissue specificity：Widely expressed in all adult tissues and in embryos. Highest levels in kidney, skeletal muscle and embryo. {ECO:0000269|PubMed:8662802}.
Induction：
Developmental stage：First detected at low levels at 10.5 dpc in cranofacial mesenchyme and in parts of the nervous system. At 12.5 dpc, high expression found in heart, diaphragm, bronchi and in the mesenchyme surrounding precartilage condensations. At later stages, expressed in dental papilla, dermis, hair follicles and in the perichondrium and in regions containing chondro and osteo progenitor cells. {ECO:0000269|PubMed:7813775}.
Protein families：Type I cytokine receptor family, Type 3 subfamily