BPIA1_MOUSE P97361
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97361
Recommended name：BPI fold-containing family A member 1
EC number：
Alternative names：(Palate lung and nasal epithelium clone protein)
Cleaved into：
GeneID：18843
Gene names (primary )：Bpifa1
Gene names (synonym )：Plunc Splunc1
Gene names (ORF )：
Length：278
Mass：28625
Sequence：MFLVGSLVVLCGLLAHSTAQLAGLPLPLGQGPPLPLNQGPPLPLNQGQLLPLAQGLPLAVSPALPSNPTDLLAGKFTDALSGGLLSGGLLGILENIPLLDVIKSGGGNSNGLVGGLLGKLTSSVPLLNNILDIKITDPQLLELGLVQSPDGHRLYVTIPLGLTLNVNMPVVGSLLQLAVKLNITAEVLAVKDNQGRIHLVLGDCTHSPGSLKISLLNGVTPVQSFLDNLTGILTKVLPELIQGKVCPLVNGILSGLDVTLVHNIAELLIHGLQFVIKV
Tissue specificity：Detected in airway epithelia (trachea and lung) and in bronchoalveolar fluid (at protein level). Upper airways, nasopharyngeal epithelium and thymus. Highest expression in the trachea and progressive decrease from proximal (bronchial) to distal (bronchiolar) airways. No expression is detected in the terminal bronchioles, respiratory bronchioles or lung alveoli. {ECO:0000269|PubMed:10224143, ECO:0000269|PubMed:11396972, ECO:0000269|PubMed:23499554}.
Induction：
Developmental stage：First detected at 14.5 dpc in the nasopharyngeal epithelium and persists there into adulthood. In the thymus, weak expression is detected at 16.5 dpc and appears to be restricted to epithelial cells lining the medullary venules. This pattern of thymic expression persists until birth and into early postnatal life but is greatly decreased in the adult thymus. No expression is detected in the lung until 2 days after birth, after which expression is detected in cells lining the trachea. {ECO:0000269|PubMed:11396972}.
Protein families：BPI/LBP/Plunc superfamily, Plunc family