SRTD1_MOUSE   Q9JL10


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JL10

Recommended name:SERTA domain-containing protein 1

EC number:

Alternative names:(CDK4-binding protein p34SEI1) (SEI-1) (Transcriptional regulator interacting with the PHD-bromodomain 1) (TRIP-Br1)

Cleaved into:

GeneID:55942

Gene names  (primary ):Sertad1

Gene names  (synonym ):Sei1

Gene names  (ORF ):

Length:236

Mass:25136

Sequence:MLSKGLKRKREEEETMEALSVDSCWLDPSHPAVAQTPPTVASSSLFDLSVVKLHHSLRQSEPDLRHLVLVVNTLRRIQASMEPAPVLPPEPIQPPAPSVADSLLASSDAGLSASMASLLEDLNHIEDLNQAPQPQADEGPPGRSIGGISPNLGALDLLGPATGCLLDDGLEGLFEDIDTSMYDSELWLPASEGLKPGPENGPAKEEPPELDEAELDYLMDVLVGTQALERPPGPGR

Tissue specificity:Detected at in testis, lung and, at lower levels, in muscle, liver, spleen, brain and heart. {ECO:0000269|PubMed:11331592}.

Induction:

Developmental stage:Detected as early as 7 dpc and persist until, at least, 17 dpc. {ECO:0000269|PubMed:11331592}.

Protein families:


   💬 WhatsApp