SYCN_RAT O35775
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35775
Recommended name：Syncollin
EC number：
Alternative names：
Cleaved into：
GeneID：245917
Gene names (primary )：Sycn
Gene names (synonym )：Sip9
Gene names (ORF )：
Length：134
Mass：14,635
Sequence：MSPLCLLLLALALVAVPGARGACPVPADLKKSDGTRTCARLYENSDPYYDNCCQGPELSVDPGTDLPYLPSDWSNSASSLVVAQRCELTVWSLPGKRGKTRKFSTGSYPRLEEYRKGIFGTWAKSISGLYCKCY
Tissue specificity：Specifically expressed in pancreas and also detected in secretory granules of parotid gland (at protein level). Expressed in pancreas, spleen, small intestine, lung and neutrophilic granulocytes (at protein level). Expressed by epithelial cells in duodenum and colon. 3 s
Induction：Expressed in gut after birth. 1 Publication
Developmental stage：Down-regulated in small intestine upon fasting. 1
Protein families：