GSDA2_MOUSE   Q32M21


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q32M21

Recommended name:Gasdermin-A2

EC number:

Alternative names:(Gasdermin-2)

Cleaved into:Gasdermin-A2, N-terminal (GSDMA2-NT); Gasdermin-A2, C-terminal (GSDMA2-CT)

GeneID:76758

Gene names  (primary ):Gsdma2

Gene names  (synonym ):Gsdm2

Gene names  (ORF ):

Length:443

Mass:49844

Sequence:MSMFEDVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTLLGNFSFKNMLDVRVEGDVEVPTMMKVKGTVGLSQSSTLEVQMLSVAPTALENLHMERKLSADHPFLKEMREYKQNLYVVMEVVKAKQEVTLKRASNAISKFSLNLPSLGLQGSVNHKEAVTIPKGCVLAYRVRQLIIYGKDEWGIPYICTDNMPTFNPLCVLQRQGSTVQMISGEMHEDFKTLKKEVQQETQEVEKLSPVGRSSLLTSLSHLLGKKKELQDLEQMLEGALDKGHEVTLEALPKDVLLLKDAMDAILYFLGALTELSEEQLKILVKSLENKVLPVQLKLVESILEQNFLQDKEDVFPLRPDLLSSLGEEDQILTEALVGLSGLEVQRSGPQYTWNPDTCHNLCALYAGLSLLHLLSRDS

Tissue specificity:Expressed in the gastrointestinal tract, specifically from the middle to the upper region of the gastric mucosa in the glandular stomach. {ECO:0000269|PubMed:17350798}.

Induction:

Developmental stage:Expression is first detected at 16.6-17.5 dpc. {ECO:0000269|PubMed:17350798}.

Protein families:Gasdermin family


   💬 WhatsApp