NANO2_MOUSE P60322
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P60322
Recommended name：Nanos homolog 2
EC number：
Alternative names：(NOS-2)
Cleaved into：
GeneID：378430
Gene names (primary )：Nanos2
Gene names (synonym )：Nos2
Gene names (ORF )：
Length：136
Mass：15597
Sequence：MDLPPFDMWRDYFNLSQVVMDIIQSRKQRQEGEVAEEPNSRPQEKSEQDLEGYPGCLPTICNFCKHNGESRHVYTSHQLKTPEGVVVCPILRHYVCPLCGATGDQAHTLKYCPLNSSQQSLYRRSGRNSAGRRVKR
Tissue specificity：Predominantly expressed in male germ cells. Expressed in self-renewing spermatogonial stem cells and developing gonads. {ECO:0000269|PubMed:12947200, ECO:0000269|PubMed:19745153}.
Induction：
Developmental stage：First detectable at 13.5 dpc in the male gonocytes, levels increase until about 16.5 dpc and then slightly decrease by 17.5 dpc (at protein level). Expression is maintained in all male gonocytes during embryogenesis, but becomes confined to a small population of the spermatogonia after birth. {ECO:0000269|PubMed:17138666, ECO:0000269|PubMed:20133598}.
Protein families：Nanos family