NQO1_MOUSE Q64669
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64669
Recommended name：NAD(P)H dehydrogenase [quinone] 1
EC number：EC 1.6.5.2
Alternative names：(Azoreductase) (DT-diaphorase) (DTD) (Menadione reductase) (NAD(P)H:quinone oxidoreductase 1) (Phylloquinone reductase) (Quinone reductase 1) (QR1)
Cleaved into：
GeneID：18104
Gene names (primary )：Nqo1
Gene names (synonym )：Dia4 Nmo1 Nmor1
Gene names (ORF )：
Length：274
Mass：30960
Sequence：MAARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETVWEETPLYFAPSSLFDLNFQAGFLMKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK
Tissue specificity：
Induction：By polycyclic hydrocarbons such as dioxin (Governed by the aromatic hydrocarbon-responsive (AH) locus).
Developmental stage：
Protein families：NAD(P)H dehydrogenase (quinone) family