MSPD1_MOUSE Q8VEL0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VEL0
Recommended name：Motile sperm domain-containing protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：70380
Gene names (primary )：Mospd1
Gene names (synonym )：
Gene names (ORF )：
Length：213
Mass：24074
Sequence：MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVIATLLPSAKEQQKEEEEKRIKEHLTESVFFEQSCQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDMESLVPLYLHLSVNQKLVAAYILGLITMAILRT
Tissue specificity：Widely expressed. Shows highest expression in ribs, and slightly lower levels of expression in heart, kidney, muscle, thymus, calvariae and lung. Also detected at low levels in spleen and liver. {ECO:0000269|PubMed:21792907}.
Induction：May be up-regulated in response to cell-cell contact. {ECO:0000269|PubMed:21792907}.
Developmental stage：Expressed at low levels in undifferentiated mesenchymal stem cells and then shows increasing expression levels as differentiation proceeds. {ECO:0000269|PubMed:21792907, ECO:0000269|PubMed:26175344}.
Protein families：