HYAL1_MOUSE   Q91ZJ9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91ZJ9

Recommended name:Hyaluronidase-1

EC number:EC 3.2.1.35

Alternative names:(Hyal-1) (Hyaluronoglucosaminidase-1)

Cleaved into:

GeneID:15586

Gene names  (primary ):Hyal1

Gene names  (synonym ):

Gene names  (ORF ):

Length:462

Mass:52109

Sequence:MLGLTQHAQKVWRMKPFSPEVSPGSSPATAGHLLRISTLFLTLLELAQVCRGSVVSNRPFITVWNGDTHWCLTEYGVDVDVSVFDVVANKEQSFQGSNMTIFYREELGTYPYYTPTGEPVFGGLPQNASLVTHLAHTFQDIKAAMPEPDFSGLAVIDWEAWRPRWAFNWDSKDIYRQRSMELVQAEHPDWPETLVEAAAKNQFQEAAEAWMAGTLQLGQVLRPRGLWGYYGFPDCYNNDFLSLNYTGQCPVFVRDQNDQLGWLWNQSYALYPSIYLPAALMGTEKSQMYVRHRVQEALRVAIVSRDPHVPVMPYVQIFYEMTDYLLPLEELEHSLGESAAQGVAGAVLWLSSDKTSTKESCQAIKAYMDSTLGPFIVNVTSAALLCSEALCSGHGRCVRHPSYPEALLTLNPASFSIELTHDGRPPSLKGTLSLKDRAQMAMKFRCRCYRGWRGKWCDKRGM

Tissue specificity:Highly expressed in liver, kidney, lung and skin. {ECO:0000269|PubMed:11929860, ECO:0000269|PubMed:9503017}.

Induction:

Developmental stage:Detected in embryos of all developmental stages, with high level at the 7 day stage. {ECO:0000269|PubMed:11929860}.

Protein families:Glycosyl hydrolase 56 family


   💬 WhatsApp