SGK2_RAT   Q8R4U9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R4U9

Recommended name:Serine/threonine-protein kinase Sgk2

EC number:EC:2.7.11.1

Alternative names:Serum/glucocorticoid-regulated kinase 2

Cleaved into:

GeneID:171497

Gene names  (primary ):Sgk2

Gene names  (synonym ):

Gene names  (ORF ):

Length:367

Mass:41,361

Sequence:MASSPVGVPSPQPSRANGNINLGPSANPNARPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKNKEQSHIMAERNVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQREHRFLEPRARFYTAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKECVEPEETTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFFNTDVAQMYENILHQPLQIPGGRTVAACDLLQGLLHKDQRQRLGSKEDFLDIKNHMFFSPINWDDLYHKRLTPPFNPNVEGPADLKHFDPEFTQEAVSKSIGCTPDTMSSSSGASSAFLGFSYAQDDDDILDS

Tissue specificity:Expressed in the proximal tubule and thick ascending limb of the loop of Henle (TALH). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp