DFB19_MOUSE Q8K3I8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K3I8
Recommended name：Beta-defensin 19
EC number：
Alternative names：(BD-19) (mBD-19) (Defensin, beta 19) (Testis-specific beta-defensin-like protein)
Cleaved into：
GeneID：246700
Gene names (primary )：Defb19
Gene names (synonym )：Defb24 Tdl
Gene names (ORF )：
Length：83
Mass：9568
Sequence：MRLALLLLAILVATELVVSGKNPILQCMGNRGFCRSSCKKSEQAYFYCRTFQMCCLQSYVRISLTGVDDNTNWSYEKHWPRIP
Tissue specificity：Specifically expressed in male gonads (Sertoli cells). {ECO:0000269|PubMed:12128228}.
Induction：
Developmental stage：Not detected at 11.5 dpc. Specific signals are observed within seminiferous cords in male gonads at 12.5, 13.5, 14.5, and 16.5 dpc and in newborn testes. In 16.5 and newborn testes, its expression is also found in epididymis. No specific signal is found in female gonads. {ECO:0000269|PubMed:12128228}.
Protein families：Beta-defensin family