SPTSB_MOUSE Q925E8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q925E8
Recommended name：Serine palmitoyltransferase small subunit B
EC number：
Alternative names：(Protein ADMP) (Small subunit of serine palmitoyltransferase B) (ssSPTb)
Cleaved into：
GeneID：66183
Gene names (primary )：Sptssb
Gene names (synonym )：Admp Sssptb
Gene names (ORF )：
Length：76
Mass：9108
Sequence：MDFKRVKEYFAWLYYQYQIITCCAVMEPWEQSMLNTIILTIVAMVVYTAYVFIPIHIRLAWEFFSKICGYDSSISN
Tissue specificity：Expression is strong in hypogonadal (hpg) mouse prostate, weak in mature castrated mouse prostate and absent in normal intact or androgen-replaced hpg mouse prostates. {ECO:0000269|PubMed:15777716}.
Induction：While expression is androgen independent in the hpg mouse prostate, it appears to be androgen-dependent in the kidney and brain of normal intact mouse suggesting tissue specific regulation by androgens. {ECO:0000269|PubMed:15777716}.
Developmental stage：
Protein families：SPTSS family, SPTSSB subfamily