PRDX1_RAT Q63716
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63716
Recommended name：Peroxiredoxin-1
EC number：EC:1.11.1.24
Alternative names：HBP23 Heme-binding 23 kDa protein Thioredoxin peroxidase 2 Thioredoxin-dependent peroxide reductase 2 Thioredoxin-dependent peroxiredoxin 1 Curated
Cleaved into：
GeneID：117254
Gene names (primary )：Prdx1
Gene names (synonym )：Tdpx2
Gene names (ORF )：
Length：199
Mass：22,109
Sequence：MSSGNAKIGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK
Tissue specificity：
Induction：
Developmental stage：
Protein families：