AG10B_RAT O88788
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88788
Recommended name：Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase By Similarity
EC number：EC:2.4.1.256
Alternative names：Alpha-1,2-glucosyltransferase ALG10-A Alpha-2-glucosyltransferase ALG10-B Asparagine-linked glycosylation protein 10 homolog B Imported Potassium channel regulator 1 1 Publication
Cleaved into：
GeneID：245960
Gene names (primary )：Alg10b
Gene names (synonym )：Kcr1 1 Publication
Gene names (ORF )：
Length：474
Mass：55,574
Sequence：MAQLEGYYFSAALSCTFLVSCLLFSAFSRALREPYMDEIFHLPQAQRYCEGRFSLSQWDPMITTLPGLYLVSVGVVKPASWILGWSEHVVCSIGMLRFVNLLFSVGNFYLLYLLFRKIQPRNKASSSIQRILSTLTLAVFPTLYFFNFLYYTEAGSVFFTLFAYLMCLYGNHRTSALLGFCGFMFRQTNIIWAAFCAGHIIAQKCSEAWKTELQKKKEERLPPAKGPLSELRRVLQFLLMYSMSLKNLSMLFLLTWPYMLLLLAFFVFVVVNGGIVVGDRSSHEACLHFPQLFYFFSFTAFFSFPHLLSPTKVKTFLSLVWKRRVQFSVITLVSVFLVWKFTYVHKYLLADNRHYTFYVWKRVFQRHEIVKYLLVPAYMFAGWAVADSLKSKSIFWNLMFFVCLVASTVPQKLLEFRYFILPYIIYRLNMPLPPISRLVCELGCYAVVNFLTFYIFLNKTFQWSDSHDIQRFMW
Tissue specificity：Highly expressed in brain, skeletal muscle, uterus, small intestine and liver. Moderately expressed in lung and kidney. Weakly expressed in heart and stomach. 1
Induction：
Developmental stage：
Protein families：