CD276_MOUSE Q8VE98
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VE98
Recommended name：CD276 antigen
EC number：
Alternative names：(B7 homolog 3) (B7-H3) (Costimulatory molecule) (CD antigen CD276)
Cleaved into：
GeneID：102657
Gene names (primary )：Cd276
Gene names (synonym )：B7h3
Gene names (ORF )：
Length：316
Mass：34001
Sequence：MLRGWGGPSVGVCVRTALGVLCLCLTGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFPPEALWVTVGLSVCLVVLLVALAFVCWRKIKQSCEEENAGAEDQDGDGEGSKTALRPLKPSENKEDDGQEIA
Tissue specificity：Ubiquitous. {ECO:0000269|PubMed:12055244}.
Induction：Up-regulated in cells mediating rejection of mouse transplant. {ECO:0000269|PubMed:15682454}.
Developmental stage：Highly expressed in developing bones during embryogenesis and expression increases as osteoblast precursor cells differentiate into mature osteoblasts. {ECO:0000269|PubMed:12925852}.
Protein families：Immunoglobulin superfamily, BTN/MOG family