K2C75_RAT Q6IG05
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6IG05
Recommended name：Keratin, type II cytoskeletal 75
EC number：
Alternative names：
Cleaved into：
GeneID：300247
Gene names (primary )：Krt75
Gene names (synonym )：Kb18
Gene names (ORF )：
Length：542
Mass：59,027
Sequence：MSRQSTVTFHSGSRRGFSTASATTPTAGRSRFSSVSVARSSGNSGGLGRISGIGSGFGSRSLYNLGATRPVSVGGCAGSGFRSGFGGRASSSFGYGGGFGGPGFPVCPSGSIQEVTVNQSLLTPLNLQIDPTIQRVRKEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQEQGSRTVRQNLEPFFDAYVNDLRRQLDSVTAERGRLDAELRHMQEVVEDFKVRYEDEINKRAAAENEFVGLKKDVDGAYMNKVELEAKVDSLTDQINFYRMVYEAELSQMQNQVSDTSVVLSMDNNRSLDLDSIIAEVKAQYEDIANRSRAEAESWYQTKYEELQVTAGRHGDDLRNTKQEISEMNRMIQRLRSEIDAVKKQCSSLQTAISDTEQRGELALKDARAKLVELEDALQKAKQDMARLLREYQELMNVKLALDVEIATYRKLLEGEECRLSGEGVSPVNISVVTSTVSSGYGGGTNIGGGSLGLGGNSGYSFTTTGGHSLGTGLGGSGFTTSSSRGPVGSGSSIKFVSSTSSSRKSYKH
Tissue specificity：
Induction：
Developmental stage：
Protein families：