ASIC4_RAT Q9JHS6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JHS6
Recommended name：Acid-sensing ion channel 4 Curated
EC number：
Alternative names：Amiloride-sensitive cation channel 4 Spinal cord ASIC 1 Publication
Cleaved into：
GeneID：63882
Gene names (primary )：Asic4
Gene names (synonym )：Accn4 Imported, Spasic 1 Publication
Gene names (ORF )：
Length：539
Mass：59,325
Sequence：MPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAAQGPAAPRDLATFASTSTLHGLGRACGPGPHGLRRTLWVLALLTSLAAFLYQAASLARGYLTRPHLVAMDPAAPAPVAGFPAVTLCNINRFRHSALSDADIFHLANLTGLPPKDRDGHRAAGLRYPEPDMVDILNRTGHQLADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPQSSLPSRAGGMGSGLEIMLDIQQEEYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQLGFGVSPGFQTFVSCQKQRLTYLPQPWGNCRAESKLREPELQGYSAYSVSACRLRCEKEAVLQRCHCRMVHMPGNETICPPNIYIECADHTLDSLGGGSEGPCFCPTPCNLTRYGKEISMVKIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIGASILTLLEILDYIYEVSWDRLKRVWRRPKTPLRTSTGGISTLGLQELKEQSPCPNRGRAEGGGASNLLPNHHHPHGPPGSLFEDFAC
Tissue specificity：Expressed in brain, spinal cord and dorsal root ganglion (DRG). Expressed by a subset of sensory neurons in the DRG. Expressed by granule cells in the cerebellar cortex. In hippocampus, expression is detected in dentate gyrus granule cells, in pyramidal cells of CA1-CA3 subfields and in interneurons of the striatum oriens and radiatum of all subfields. In cerebral cortex expressed in small, medium and large pyramidal cells in layers 2, 3 and 5 respectively. Also expressed in striatum, globus pallidus, inferior and superior calliculi, amygdala, magnocellular preoptic nucleus, islands of Calleja and large neurons of olfactory tubercules. 1
Induction：
Developmental stage：Highly expressed in newborn spinal cord but hardly detected in the cerebellum compared to adult. Expressed at postnatal day 1 in ependymal cells lining the central canal of spinal cord and in motor neurons. In adult, expression decreases in ependymal cells and increases in motor neurons. The number of positive interneurons decreases but the individual interneuron expression increases in adult spinal cord compared to newborn. 1
Protein families：