CHIO_RAT   Q03070


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q03070

Recommended name:Beta-chimaerin

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Chn2

Gene names  (synonym ):Arhgap3, Bch

Gene names  (ORF ):

Length:295

Mass:33,837

Sequence:MLCTSPVNCLDSVCCTSINISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRDLPIPIITYDTYTKFIEAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNLMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF

Tissue specificity:Found in cerebellum and testis.

Induction:

Developmental stage:Expressed specifically in late stage spermatocytes. In the cerebellum, emergence of beta-2 isoform coincides with granule cells maturation and exhibits postnatal developmental increases. Expression is specifically reduced in weaver mutant.

Protein families:


   💬 WhatsApp