B2LA1_MOUSE Q07440
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q07440
Recommended name：Bcl-2-related protein A1
EC number：
Alternative names：(A1-A) (Hemopoietic-specific early response protein) (Protein BFL-1)
Cleaved into：
GeneID：12044
Gene names (primary )：Bcl2a1
Gene names (synonym )：A1 Bcl2a1a Bfl1
Gene names (ORF )：
Length：172
Mass：19914
Sequence：MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSSFVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLLK
Tissue specificity：Expressed in hemopoietic tissues, including bone marrow, spleen and thymus.
Induction：By granulocyte-macrophage colony-stimulating factor and LPS in macrophages.
Developmental stage：
Protein families：Bcl-2 family