PRIMA_RAT   D3ZZP4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:D3ZZP4

Recommended name:Proline-rich membrane anchor 1

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Prima1

Gene names  (synonym ):

Gene names  (ORF ):

Length:153

Mass:16,495

Sequence:MLLRDLVLRHGCCWPSLLLHCALHPLWGLVQVTHAEPQKSCSKVTDSCQHICQCRPPPPLPPPPPPPPPPRLLSAPAPNSTSCPAEDSWWSGLVIIVAVVCASLVFLTVLVIICYKAIKRKPLRKDENGASVAEYPMSSSPSNKGVDVNAAVV

Tissue specificity:Isoforms 1 and 2 are expressed in the adult brain. In matured cortical neurons, only isoform 1 is detectable. 2 s

Induction:

Developmental stage:Up-regulated during the differentiation of in vitro cultured cortical neurons.

Protein families:


   💬 WhatsApp