STK11_RAT D4AE59
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D4AE59
Recommended name：Serine/threonine-protein kinase STK11 Curated
EC number：EC:2.7.11.1
Alternative names：Liver kinase B1 homolog (LKB1)
Cleaved into：
GeneID：
Gene names (primary )：Stk11
Gene names (synonym )：Lkb1
Gene names (ORF )：
Length：436
Mass：49,246
Sequence：MDVADPQPLGLFPEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHRNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFRQLIDGLEYLHSQGIVHKDIKPGNLLLTTNGTLKISDLGVAEALHPFAVDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGRGDFTIPCDCAPPLSDLLRGMLEYEPAKRFSIRQIRQHSWFRKKHPLAEALVPIPPSPDTKDRWRSMTVVPYLEDLHGRAEEEEDEDLFDIEDGIIYTQDFTVPGQVLEEEVGQNGQSHSLPKAVCVNGTEPQLSSKVKPEGRPGAANPARKVCSSNKIRRLSACKQQ
Tissue specificity：Expressed in brain, heart, testis, skeletal muscle and spleen, and weakly in liver and kidney. Isoform 1 is expressed at highest levels in the brain. Isoform 2 is expressed at highest levels in the testis, primarily in postmitotic developing germ cells (at protein level). 1
Induction：
Developmental stage：Isoform 2 is expressed in testis from 30 days of age, with significantly increased levels by 60 days; this corresponds to the stage when haploid spermatids appear. 1
Protein families：