CILK1_MOUSE Q9JKV2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JKV2
Recommended name:Serine/threonine-protein kinase ICK
EC number:EC 2.7.11.1
Alternative names:(Intestinal cell kinase) (mICK) (MAK-related kinase) (MRK)
Cleaved into:
GeneID:56542
Gene names (primary ):Cilk1
Gene names (synonym ):Ick
Gene names (ORF ):
Length:629
Mass:70592
Sequence:MNRYTTIKQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANIVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSTNYSSPIDIWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFLWPQCIPNNLKTLIPNASSEAIQLLRDLLQWDPKKRPTASQALRYPYFQIGHPLGIISKDSGKPQREVQDKTGPPPYIKPAPPAQAPAKAYTLISSRPSQASQPPQHSVHPYKGDVSRTEQLSHVQEGKPSPPFFPSLHNKNLQPKILASLEQKNGEIKPKSRRRWGLISRSTKGSDDWADLDDLDFSPSLTRIDVKNKKRQSDDTLCRFESVLDLKPSESVGTGTTVSTQASSQRRDTPTLQSSAKQHYLKHSRYLPGINIRNGVLPNPGKDFLPSNSWSSSGLSGKSSGTVSVVSKITSVGSGSASSSGLTGSYIPSFLKKEIGSVMQRVQLAPLAAPPPGYSSLKAVRPHPGRPFFHTQPRSTPGLIPRPPAAQPVHGRIDWSSKYPSRR
Tissue specificity:Highly expressed in colon and lung, lower levels present in heart, esophagus, stomach, small intestine and ovary. Localizes to the crypt region of large and small intestine. {ECO:0000269|PubMed:10699974}.
Induction:
Developmental stage:At 14.5 dpc, expressed in the brain cortex, including the cortical plate, intermediate zone, and ventricular and subventricular zones. {ECO:0000269|PubMed:29539279}.
Protein families:Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily