EFNA2_MOUSE P52801
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P52801
Recommended name：Ephrin-A2
EC number：
Alternative names：(CEK7-ligand) (CEK7-L) (ELF-1) (EPH-related receptor tyrosine kinase ligand 6) (LERK-6)
Cleaved into：
GeneID：13637
Gene names (primary )：Efna2
Gene names (synonym )：Elf1 Epl6 Eplg6 Lerk6
Gene names (ORF )：
Length：209
Mass：23586
Sequence：MAPAQRPLLPLLLLLLPLRARNEDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPIFTSNSSCSGLGGCHLFLTTVPVLWSLLGS
Tissue specificity：Expressed in myogenic progenitor cells. {ECO:0000269|PubMed:27446912}.
Induction：
Developmental stage：In myogenic progenitor cells, highly expressed, at least as early as 11.5 dpc, expression decreases gradually until adulthood. {ECO:0000269|PubMed:27446912}.
Protein families：Ephrin family