CETN1_MOUSE P41209
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P41209
Recommended name：Centrin-1
EC number：
Alternative names：(Caltractin)
Cleaved into：
GeneID：26369
Gene names (primary )：Cetn1
Gene names (synonym )：Calt
Gene names (ORF )：
Length：172
Mass：19696
Sequence：MASTFRKSNVASTSYKRKVGPKPELTEDQKQEVREAFDLFDSDGSGTIDVKELKVAMRALGFEPRKEEMKKMISEVDKEATGKISFNDFLAVMTQKMAEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGESLTDEELQEMIDEADRDGDGEVNEEEFLKIMKKTNLY
Tissue specificity：Expressed in testis. Localizes to the caudal portion of spermatozoa in seminiferous tubule and epididymis (PubMed:10486202). Expressed in retina photoreceptor cells (at protein level) (PubMed:30120214). {ECO:0000269|PubMed:10486202, ECO:0000269|PubMed:30120214}.
Induction：
Developmental stage：First expressed at 14 days postpartum (dpp). Levels increase dramatically between 14 dpp and 17 dpp. {ECO:0000269|PubMed:10486202}.
Protein families：Centrin family