DHI2_MOUSE   P51661


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P51661

Recommended name:Corticosteroid 11-beta-dehydrogenase isozyme 2

EC number:EC 1.1.1.-

Alternative names:(11-beta-hydroxysteroid dehydrogenase type 2) (11-DH2) (11-beta-HSD2) (NAD-dependent 11-beta-hydroxysteroid dehydrogenase)

Cleaved into:

GeneID:15484

Gene names  (primary ):Hsd11b2

Gene names  (synonym ):Hsd11k

Gene names  (ORF ):

Length:386

Mass:42187

Sequence:MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALVVLAGAGWIALSRLARPPRLPVATRAVLITGCDTGFGKETAKKLDAMGFTVLATVLDLNSPGALELRDLCSPRLKLLQMDLTKAEDISRVLEITKAHTASTGLWGLVNNAGLNIVVADVELSPVATFRKCMEVNFFGALELTKGLLPLLRHSRGRIVTVGSPAGDMPYPCLAAYGTSKAAIALLMDTFGCELLPWGIKVSIIKPGCFKTDAVTNVNLWEKRKQLLLANIPRELLQAYGEDYIEHVHGQFLNSLRMALPDLSPVVDAIIDALLAAQPRSRYYPGRGLGLMYFIHHYLPEGLRRCFLQNFFINHLLPRALRPGQHGPAPA

Tissue specificity:Highly expressed in kidney. Also found in colon and small intestine. Not expressed in the adrenal gland.

Induction:

Developmental stage:

Protein families:Short-chain dehydrogenases/reductases (SDR) family


   💬 WhatsApp