BODG_RAT Q9QZU7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QZU7
Recommended name：Gamma-butyrobetaine dioxygenase
EC number：EC:1.14.11.1
Alternative names：Gamma-butyrobetaine hydroxylase 1 Publication (Gamma-BBH) Gamma-butyrobetaine,2-oxoglutarate dioxygenase
Cleaved into：
GeneID：64564
Gene names (primary )：Bbox1
Gene names (synonym )：Bbh 1 Publication
Gene names (ORF )：
Length：387
Mass：44,546
Sequence：MHCAILKAEAVDGARLMQIFWHDGAESLYPAVWLRDNCQCSDCYLHSAKARKLLLEALDVNIRMDDLTFDQKKVYITWPNGHYSEFEANWLKKRCFSQEARAGLQGELFLPECQYWGSELQLPTLNFEDVLNDDDHAYKWLSSLKKVGIVRLTGAADKRGEIIKLGKRIGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKEKNPQAFSILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTVFDVPIERVQPFYAALKEFVDLMNSKEYKYTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVMNGN
Tissue specificity：Expressed in the liver and in some extend in the testis and the epididymis. 1
Induction：
Developmental stage：Undetectable during the perinatal period. During development, expression appears after the weaning of the young rat and reaches a maximal expression at the adult stage. 1
Protein families：