IFT52_MOUSE Q62559
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62559
Recommended name：Intraflagellar transport protein 52 homolog
EC number：
Alternative names：(Protein NGD5)
Cleaved into：
GeneID：245866
Gene names (primary )：Ift52
Gene names (synonym )：Ngd5
Gene names (ORF )：
Length：426
Mass：48248
Sequence：MEKELRSTILFNAYKKEVFTTNTGYKSLQKRLRSNWKIQSLKDEITSEKLIGVKLWITAGPREKFTAAEFEVLKKYLDSGGDILVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVYYKYFHPKEALVSDGVLNREISRAAGKAVPGVIDEENSGNNAQALTFVYPFGATLSVMKPAVAVLSTGSVCFPLNRPILAFYHSKNQGFGKLAVLGSCHMFSDQYLDKEENSKIMDVVFQWLTTGDIHLNQIDAEDPEISDYTMVPDTATLSEQLRVCLQEGDENPRDFTTLFDLSIYQLDTTCLPKVIKAHEELNVKHEPLQLVQPQFEMPLPALQPAVFPPSFRELPPPPLELFDLDETFSSEKARLAQITNKCTDEDLEFYVRKCGDILGVTSKLPKDQQDAKHILEHIFFQVVEFKKLNQEAH
Tissue specificity：
Induction：After opioid treatment, expression decreases.
Developmental stage：
Protein families：