5MP1_RAT Q9WTT7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WTT7
Recommended name：eIF5-mimic protein 1 By Similarity
EC number：
Alternative names：
Cleaved into：
GeneID：171439
Gene names (primary )：Bzw2
Gene names (synonym )：5mp1 By Similarity, Bdm2, Hfb2
Gene names (ORF )：
Length：419
Mass：48,049
Sequence：MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSEAEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCVMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELVLLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHAAKGKSVFLDQMKKFVEWLQNAEEESESEGEES
Tissue specificity：Expressed at high levels in heart, and at lower levels in skeletal muscle, spleen and lung. Expressed at low levels in brain regions where nascent and immature neurons are present. 1
Induction：
Developmental stage：Expressed at 8 dpc. In brain, expression increases between 14 dpc and 16 dpc, reaches a plateau at 18 dpc, and subsequently decreases. 1
Protein families：