HESX1_MOUSE Q61658
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61658
Recommended name：Homeobox expressed in ES cells 1
EC number：
Alternative names：(Anterior-restricted homeobox protein) (Homeobox protein ANF) (Rathke pouch homeo box)
Cleaved into：
GeneID：15209
Gene names (primary )：Hesx1
Gene names (synonym )：Hes-1 Rpx
Gene names (ORF )：
Length：185
Mass：21504
Sequence：MSPSLREGAQLRESKPAPCSFSIESILGLDQKKDCTTSVRPHRPWTDTCGDSEKGGNPPLHAPDLPSETSFPCPVDHPRPEERAPKYENYFSASETRSLKRELSWYRGRRPRTAFTQNQVEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKMKRSRRESQFLMAKKPFNPDLLK
Tissue specificity：High levels found in the embryonic liver, lower level expression seen in the viscera, amnion and yolk sac.
Induction：Down-regulated during embryonic stem (ES) cell differentiation.
Developmental stage：Early expression seen in the anterior midline endoderm and prechordal plate precursor, subsequently activated in the overlying ectoderm of the cephalic neural plate. Later disappears in the mesendoderm while remaining in the prospective prosencephalic region of the neural plate ectoderm, ultimately expression is restricted to Rathke pouch, the primordium of the pituitary. Expressed in embryonic stem cells. {ECO:0000269|PubMed:1360650}.
Protein families：ANF homeobox family