GMPR1_RAT   Q9Z244


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z244

Recommended name:GMP reductase 1 UniRule Annotation

EC number:EC:1.7.1.7

Alternative names:GMPR 1 UniRule Annotation

Cleaved into:

GeneID:117533

Gene names  (primary ):Gmpr

Gene names  (synonym ):Gmpr1 UniRule Annotation

Gene names  (ORF ):

Length:345

Mass:37,488

Sequence:MPRIDADLKLDFKDVLLRPKRSSLKSRSEVDLERTFTFRNSKQTYSGIPVIVANMDTVGTFEMAVVMSQHAMFTAIHKHYSLDDWKHFAENHPECLQHVAVSSGSGQNDLEKMSLILEAVPQVKFICLDVANGYSEHFVEFVKLVRSKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGSCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGQKLKLFYGMSSDTAMKKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFG

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp