UB2V2_RAT   Q7M767


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7M767

Recommended name:Ubiquitin-conjugating enzyme E2 variant 2

EC number:

Alternative names:

Cleaved into:

GeneID:287927

Gene names  (primary ):Ube2v2

Gene names  (synonym ):Mms2, Uev2

Gene names  (ORF ):

Length:145

Mass:16,353

Sequence:MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGSKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

Tissue specificity:By angiotensin-II or its agonist CGP42112A, via MTUS1 and PTPN6 (at protein level). 1

Induction:

Developmental stage:Highly expressed in embryonic cerebral cortex, hippocampus and cerebellum between day 18 and up to birth. Levels are distictly lower 10 days after birth, and not detectable in adults (at protein level). 2 s

Protein families:


   💬 WhatsApp