VATC2_RAT Q6AYE4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6AYE4
Recommended name：V-type proton ATPase subunit C 2
EC number：
Alternative names：Vacuolar proton pump subunit C 2
Cleaved into：
GeneID：
Gene names (primary )：Atp6v1c2
Gene names (synonym )：
Gene names (ORF )：
Length：425
Mass：48,243
Sequence：MSEFWLISAPGDKENLQALERMNSVTSKSNLSHNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIKRMAQSVVEVMEDSKGKVHENLLANGVDLTSFVTHFEWDMAKYPAKQPLVSVVDTLAKQLAQIETDLKSRTAAYSVLKANLENLEKKSTGNLFTRTLSDIVSKEDFVLDSEYLITLLVIVPKSSYVQWQKTYESLSDMVVPRSTKLIAEDNEGGLFTVTLFRKVIEDFKVKAKENKFIVREFYYDEKEIKREREEMTRLLSDKKQQYQTSCVALKKGSATYRDHKVKVTPLGNPTRPTAGQNDRESEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSATKRLREVLNSVFRHLDEVAAASILDASVEIPGLQLSNQDYFPYVYFHIDLSLLD
Tissue specificity：Lung, kidney and testis. Expressed in both bronchiolar and alveolar lung epithelial cells. Isoform 1 is predominantly expressed in the lung while isoform 2 is strongly expressed in the kidney and testis. 1
Induction：
Developmental stage：
Protein families：