CCR4_MOUSE   P51680


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P51680

Recommended name:C-C chemokine receptor type 4

EC number:

Alternative names:(C-C CKR-4) (CC-CKR-4) (CCR-4) (CCR4) (CD antigen CD194)

Cleaved into:

GeneID:12773

Gene names  (primary ):Ccr4

Gene names  (synonym ):Cmkbr4

Gene names  (ORF ):

Length:360

Mass:41408

Sequence:MNATEVTDTTQDETVYNSYYFYESMPKPCTKEGIKAFGEVFLPPLYSLVFLLGLFGNSVVVLVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLCKIVSWMYLVGFYSGIFFIMLMSIDRYLAIVHAVFSLKARTLTYGVITSLITWSVAVFASLPGLLFSTCYTEHNHTYCKTQYSVNSTTWKVLSSLEINVLGLLIPLGIMLFCYSMIIRTLQHCKNEKKNRAVRMIFAVVVLFLGFWTPYNVVLFLETLVELEVLQDCTLERYLDYAIQATETLAFIHCCLNPVIYFFLGEKFRKYITQLFRTCRGPLVLCKHCDFLQVYSADMSSSSYTQSTVDHDFRDAL

Tissue specificity:Expressed in the thymus, macrophages and T- and B-cells.

Induction:

Developmental stage:Low expression at 7.5 dpc and 12.5 dpc in the yolk sac.

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp