TRM2A_MOUSE Q8BNV1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BNV1
Recommended name：tRNA (uracil-5-)-methyltransferase homolog A
EC number：EC 2.1.1.-
Alternative names：(HpaII tiny fragments locus 9c protein)
Cleaved into：
GeneID：15547
Gene names (primary )：Trmt2a
Gene names (synonym )：Htf9-c Htf9c
Gene names (ORF )：
Length：574
Mass：63301
Sequence：MSEPAAEVPEPMEDCGQDASAVPSSAAPLCQKEEAGPGPAAGPGTQPGLYSYIRDDLFTSEIFKLELQNVPRHASFSDVRRFLGRFGLQSHKIKLFGQPPCAFVTFRSAAERDKALRVLHGALWKGCPLSVRLARPKADPMARKRRQEGDSEPSVTQIADVVTPLWTVPYTEQLEQKRLECERVLQKLAKEIGNTNRALLPWLLLQRQQHNKACCPLEGVKPSPQQTEYRNKCEFLVGVGVDGKDNTVGCRLGKYKGGTCAVAAPFDTVHIPEATKQVVKAFQEFIRSTPYSAYDPETYTGHWKQLTVRTSSRGQAMAIAYFHPQKLSSEEVAGLKASLVCHFMEGPGKASGVTSLYFVEEGQRKTPSQEGLPLEHMAGDQCIQEDLLGLTFRISPHAFFQVNTPAAEVLYTVIQEWAQLDGGSTVLDVCCGTGTIGLALAPKVKRVVGIELCQEAVEDARMNALTNDSKVILAIRKAENIKRLLYVSCNPRAAMGNFVDLCRAPSNRVKGTPFHPVKAVAVDLFPQTPHCEMLILFERMQQHPNGIEALEHQEFQTPRNLPDITPQETEISLS
Tissue specificity：Widely expressed at low level. Expressed at higher level in proliferating cells.
Induction：In a cell-cycle manner. Transcription is activated at the G1/S transition of the cell cycle and peaks in S phase, while being repressed in quiescent tissues and growth-arrested cells.
Developmental stage：
Protein families：Class I-like SAM-binding methyltransferase superfamily, RNA M5U methyltransferase family