IL36A_MOUSE Q9JLA2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JLA2
Recommended name：Interleukin-36 alpha
EC number：
Alternative names：(FIL1 epsilon) (Interleukin-1 epsilon) (IL-1 epsilon) (Interleukin-1 family member 6) (IL-1F6) (Interleukin-1 homolog 1) (IL-1H1)
Cleaved into：
GeneID：54448
Gene names (primary )：Il36a
Gene names (synonym )：Fil1e Il1e Il1f6 Il1h1
Gene names (ORF )：
Length：160
Mass：18015
Sequence：MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH
Tissue specificity：Highly expressed in embryonic tissue and in tissues containing epithelial cells. Elevated expression levels are detected in chronic kidney disease; expressed inepithelia from the distal convoluted tubules (DCTs) to the cortical collecting ducts (CCDs) in single nephrons (at protein level). {ECO:0000269|PubMed:11466363, ECO:0000269|PubMed:20101239}.
Induction：By IL-22 in normal and psoriasis-like skin. {ECO:0000269|PubMed:21881584}.
Developmental stage：
Protein families：IL-1 family