IFT46_MOUSE   Q9DB07


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DB07

Recommended name:Intraflagellar transport protein 46 homolog

EC number:

Alternative names:

Cleaved into:

GeneID:76568

Gene names  (primary ):Ift46

Gene names  (synonym ):

Gene names  (ORF ):

Length:301

Mass:34054

Sequence:MADNSSDEYEEDNKEKKKPSQLTPQQGFSENDDDDDDDSSETDSDDDDDDEEHGAPLEGAYDPADYEHLPVSAEIKELFEYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPDGKPDHLGLLVLDEPSTKQSDPTVLSLWLTENSKQHNITQHMKVKSLEDAEKNPKAIDTWIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEFEELLGKVSLPTVEIDCSLAEYIDMICAILDIPFYKSRIQSLHLLFSLYSEFKNSQHFKALAEGKKVFTPPPNSASQAGDAETLTFI

Tissue specificity:Strongly expressed in ovary and testis, moderately expressed in kidney and brain, and weakly expressed in thymus, heart, lung, liver, spleen and muscle. Expressed in embryonic bone and cartilage, with high expression in non-hypertrophic chondrocytes and weaker expression in hypertrophic chondrocytes. {ECO:0000269|PubMed:17720815}.

Induction:By BMP2. {ECO:0000269|PubMed:17720815}.

Developmental stage:Expressed from 8 dpc throughout embryonic development, with levels increasing at 12.5 dpc and remaining constant thereafter. Up-regulated during chondrocyte maturation and skeletogenesis. {ECO:0000269|PubMed:17720815}.

Protein families:IFT46 family


   💬 WhatsApp