PO2F3_MOUSE   P31362


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P31362

Recommended name:POU domain, class 2, transcription factor 3

EC number:

Alternative names:(Epoc-1) (Octamer-binding protein 11) (Oct-11) (Octamer-binding transcription factor 11) (OTF-11)

Cleaved into:

GeneID:

Gene names  (primary ):Pou2f3

Gene names  (synonym ):Epoc1 Oct11 Otf-11 Otf11

Gene names  (ORF ):

Length:431

Mass:47071

Sequence:MVNLEPMHTEIKMSGDVADSTDTRSTFGQVEPGNDRNGLDFNRQIKTEDLGDSLQQTLSHRPCHLSQGPTMMPGNQMSGDMASLHPLQQLVLVPGHLQSVSQFLLSQTPPGQQGLQPNLLSFPQQQSTLLLPQTGPGLRSQAVGRPGLSGSSLEPHLDAPQHLPGPKHLPGPGGNDEPTDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDPESSPSDPSASTPSSYPTLSEVFGRKRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPVKPPIYNSRLVSPSGSLGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAMNSSSSSSFNSSGSWYRWNHPTYLH

Tissue specificity:Skin, thymus, stomach and testis.

Induction:

Developmental stage:During embryogenesis and in adults.

Protein families:POU transcription factor family, Class-2 subfamily


   💬 WhatsApp