M1IP1_RAT   Q6P7D5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6P7D5

Recommended name:Mid1-interacting protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:404280

Gene names  (primary ):Mid1ip1 By Similarity

Gene names  (synonym ):Mig12 Imported

Gene names  (ORF ):

Length:183

Mass:20,414

Sequence:MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLSEPDLDNEVSVEVGGSGSCLEERTTPAPSPGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPSSPPAGSEEGTWKPKDILVGLSHLESTDAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFSNWGH

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp