NPY6R_MOUSE Q61212
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61212
Recommended name：Neuropeptide Y receptor type 6
EC number：
Alternative names：(NPY6-R) (Pancreatic polypeptide receptor 2) (PP2)
Cleaved into：
GeneID：18169
Gene names (primary )：Npy6r
Gene names (synonym )：Npy5r Ppyr2 Y2b
Gene names (ORF )：
Length：371
Mass：42714
Sequence：MEVLTNQPTPNKTSGKSNNSAFFYFESCQPPFLAILLLLIAYTVILIMGIFGNLSLIIIIFKKQREAQNVTNILIANLSLSDILVCVMCIPFTVIYTLMDHWVFGNTMCKLTSYVQSVSVSVSIFSLVLIAIERYQLIVNPRGWKPRVAHAYWGIILIWLISLTLSIPLFLSYHLTNEPFHNLSLPTDIYTHQVACVEIWPSKLNQLLFSTSLFMLQYFVPLGFILICYLKIVLCLRKRTRQVDRRKENKSRLNENKRVNVMLISIVVTFGACWLPLNIFNVIFDWYHEMLMSCHHDLVFVVCHLIAMVSTCINPLFYGFLNKNFQKDLMMLIHHCWCGEPQESYENIAMSTMHTDESKGSLKLAHIPTGI
Tissue specificity：Kidney and discrete regions of the hypothalamus including the suprachiasmatic nucleus, anterior hypothalamus, bed nucleus stria terminalis, and the ventromedial nucleus.
Induction：
Developmental stage：Expressed in embryo at 7 dpc. {ECO:0000269|PubMed:8910373}.
Protein families：G-protein coupled receptor 1 family