TAFA5_MOUSE Q91WE9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91WE9
Recommended name：Chemokine-like protein TAFA-5
EC number：
Alternative names：
Cleaved into：
GeneID：106014
Gene names (primary )：Tafa5
Gene names (synonym )：Fam19a5
Gene names (ORF )：
Length：132
Mass：14331
Sequence：MAPSPRTSSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS
Tissue specificity：Expressed in the subcutaneous, brown, epididymal and perirenal adipose tissue (at protein level). {ECO:0000269|PubMed:29453251}.
Induction：Repressed in epididymal adipose tissue of diet-induced obese mice or leptin receptor-deficient mice. {ECO:0000269|PubMed:29453251}.
Developmental stage：
Protein families：TAFA family