SPRN_RAT   Q5BIV7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5BIV7

Recommended name:Shadow of prion protein

EC number:

Alternative names:

Cleaved into:

GeneID:541462

Gene names  (primary ):Sprn

Gene names  (synonym ):

Gene names  (ORF ):

Length:147

Mass:14,712

Sequence:MNWTTATCWALLLATAFLCDSCSAKGGRGGARGSARGVRGGARGASRVRVRPAPRYSSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSGSGSVHSPRICLLLSGTLGALELLRP

Tissue specificity:Almost exclusively expressed in brain, with weak expression in lung and stomach. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp