SYUG_RAT   Q63544


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q63544

Recommended name:Gamma-synuclein

EC number:

Alternative names:

Cleaved into:

GeneID:64347

Gene names  (primary ):Sncg

Gene names  (synonym ):

Gene names  (ORF ):

Length:123

Mass:12,976

Sequence:MDVFKKGFSIAREGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKGERGTSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEEGEEAKSGGD

Tissue specificity:Specifically expressed in the peripheral nervous system. High expression in motoneurons of the brainstem. Also found in neurons of many other brain regions including the cerebellar cortex, thalamus, hypothalamus and CA1, CA2, CA3 and CA4 regions of the hippocampus. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp