HXB1_MOUSE P17919
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P17919
Recommended name:Homeobox protein Hox-B1
EC number:
Alternative names:(Homeobox protein Hox-2.9)
Cleaved into:
GeneID:15407
Gene names (primary ):Hoxb1
Gene names (synonym ):Hox-2.9 Hoxb-1
Gene names (ORF ):
Length:297
Mass:31672
Sequence:MDYNRMSSFLEYPLCNRGPSAYSAPTSFPPCSAPAVDSYAGESRYGGGLPSSALQQNSGYPVQQPPSSLGVSFPSPAPSGYAPAACNPSYGPSQYYSVGQSEGDGSYFHPSSYGAQLGGLPDSYGAGGVGSGPYPPPQPPYGTEQTATFASAYDLLSEDKESPCSSEPSTLTPRTFDWMKVKRNPPKTAKVSELGLGAPGGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREGGRMPAGPPGCPKEAAGDASDQSACTSPEASPSSITS
Tissue specificity:
Induction:
Developmental stage:Expressed along the entire length of the primitive streak. In early neurogenesis it is expressed in lateral and paraxial mesoderm, endoderm and superficial ectoderm or in the neural tube. From late neurogenesis to mid-embryogenesis, it presents similar spatial domains in the lateral mesoderm, endoderm and superficial ectoderm but is not detectable in the posterior hindbrain and has increased dramatically in rhombomere 4.
Protein families:Antp homeobox family, Labial subfamily