VDAC2_RAT P81155
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P81155
Recommended name：Non-selective voltage-gated ion channel VDAC2 Curated
EC number：
Alternative names：B36-VDAC Outer mitochondrial membrane protein porin 2
Cleaved into：
GeneID：83531
Gene names (primary )：Vdac2
Gene names (synonym )：
Gene names (ORF )：
Length：295
Mass：31,746
Sequence：MAECCVPVCQRPICIPPPYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVSGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRSNFAVGYRTGDFQLHTNVNNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSFNAGGHKLGLALELEA
Tissue specificity：Highly expressed in heart, kidney, brain and ascitic tumor with very low levels in liver (PubMed:10998068). Expressed in the head region of epididymal sperm (PubMed:19423663). 2 s
Induction：
Developmental stage：
Protein families：eukaryotic mitochondrial porin family