KLRG1_MOUSE O88713
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88713
Recommended name：Killer cell lectin-like receptor subfamily G member 1
EC number：
Alternative names：(Mast cell function-associated antigen 2F1)
Cleaved into：
GeneID：50928
Gene names (primary )：Klrg1
Gene names (synonym )：Mafa
Gene names (ORF )：
Length：188
Mass：21396
Sequence：MADSSIYSTLELPEAPQVQDESRWKLKAVLHRPHLSRFAMVALGLLTVILMSLLMYQRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY
Tissue specificity：Expressed specifically on natural killer (NK) cells and activated CD8 T-cells. Not detected in spleen, thymus, lymph node, testis, brain or kidney. Not detected on mast cell lines, bone marrow-derived mast cells, or peritoneal mast cells. {ECO:0000269|PubMed:9862378, ECO:0000269|PubMed:9862665}.
Induction：By pathogens and viruses infections. {ECO:0000269|PubMed:11673487, ECO:0000269|PubMed:11884419}.
Developmental stage：
Protein families：