PR7A2_RAT Q9R006
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R006
Recommended name:Prolactin-7A2
EC number:
Alternative names:
Cleaved into:
GeneID:64361
Gene names (primary ):Prl7a2
Gene names (synonym ):Prl7a3, Prlpf
Gene names (ORF ):
Length:250
Mass:28,882
Sequence:MQLSFSRPRPWTLLLMVVSNLLLWENVSSGNLNSNETDGDLLLHRGLFDTATRLSQDIRDLDIEFLRMYAVNEVSEKLYNKHMLEFIEDMDFVVKALTCCHNYSIKTPENLDEAQQIPFNDFPWLILSRMWGWNETSKNLLTILRSIPGMHDDVISLAQAIERKLAELFEYTQSILTLIFGPTENVDRSIFSGLEDLKASDEELRFFALCKFSYCLRVDLQTIELYFKLLQCAVNVNSNVCLSINSEDSS
Tissue specificity:Expression restricted to placental tissues. Trophoblast giant cells are found to be the major source.
Induction:
Developmental stage:
Protein families: