NRN1_RAT O08957
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O08957
Recommended name：Neuritin
EC number：
Alternative names：
Cleaved into：
GeneID：83834
Gene names (primary )：Nrn1
Gene names (synonym )：
Gene names (ORF )：
Length：142
Mass：15,289
Sequence：MGLKLNGRYISLILAVQIAYLVQAVRAAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNGAAGSLLPALSVLLVSLSAALATWLSF
Tissue specificity：Expressed predominantly in brain (at protein level). Highest expression in the dentate gyrus and lowest expression in the striatum. Concentrated on neuronal cell bodies and unevenly dispersed along neuritic projections in the nonmyelinated regions of the brain. Expressed in postmitotic-differentiating neurons of the developmental nervous system and neuronal structures associated with plasticity in the adult. 2 s
Induction：Expression first detected in developing brain at embryonic day 15; the level of expression increases throughout embryonic development and postnatally into adulthood. 1 Publication
Developmental stage：Induced by neural activity and by the activity-regulated neurotrophins BDNF and NTF3. 1
Protein families：